cDNA FLJ75722, highly similar to Homo sapiens colony stimulating factor 1 (CSF1), transcript variant 1, mRNA (Colony stimulating factor 1 (Macrophage), isoform CRA_a)

UniProt : A8K6J5, P09603, UniProt ID: A8K6J5_HUMAN, CSF1_HUMAN,

cDNA FLJ75722, highly similar to Homo sapiens colony stimulating factor 1 (CSF1), transcript variant 1, mRNA (Colony stimulating factor 1 (Macrophage), isoform CRA_a)

Homo sapiens

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75722, highly similar to Homo sapiens colony stimulating factor 1 (CSF1), transcript variant 1, mRNA (Colony stimulating factor 1 (Macrophage), isoform CRA_a) contains a PF05337 domain.

cDNA FLJ75722, highly similar to Homo sapiens colony stimulating factor 1 (CSF1), transcript variant 1, mRNA (Colony stimulating factor 1 (Macrophage), isoform CRA_a) contains a PF05337 domain.

cDNA FLJ75722, highly similar to Homo sapiens colony stimulating factor 1 (CSF1), transcript variant 1, mRNA (Colony stimulating factor 1 (Macrophage), isoform CRA_a) is proteolytically cut by () cleavage..