Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA)

UniProt : Q5M8T4, UniProt ID: Q5M8T4_HUMAN,

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA)

Homo sapiens

MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) contains a PF00219 domain.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) contains a PF00093 domain.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) contains a PF00090 domain.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) contains a PF00007 domain.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. PALA-AYRL.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. PALA-AYRL.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. ALAA-YRLE.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. AAYR-LEDT.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. AAYR-LEDT.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. DPTM-IRAN.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DPTM-IRAN.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DPTM-IRAN.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DPTM-IRAN.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. ALAA-YRLE.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ALAA-YRLE.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. RANC-LVQT.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. RANC-LVQT.

Connective tissue growth factor (cDNA FLJ77666, highly similar to Homo sapiens connective tissue growth factor (CTGF), mRNA) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. RANC-LVQT.