Syntaxin-7

UniProt : O15400, UniProt ID: STX7_HUMAN,

Syntaxin-7

Homo sapiens

MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVA
RVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI
IILILVIGVAIISLIIWGLNH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syntaxin-7 contains a PF00804 domain.

Syntaxin-7 contains a PF05739 domain.

Syntaxin-7 is proteolytically cut by caspase () cleavage. DVID-SIEA.