Putative phosphorylated IMV membrane protein (Essential immature viral membrane protein p21)

UniProt : Q49PI1, UniProt ID: Q49PI1_9POXV,

Putative phosphorylated IMV membrane protein (Essential immature viral membrane protein p21)

Vaccinia virus

MSYLRYYNMLDDFSAGAGVLDKDLFTEEQQQSFMPKDGGMMQNDYGGMNDYLGIFKNNDV
RTLLGLILFVLALYSPPLISILMIFISSFLLPLTSLVITYCLVTQMYRGGNGNTVGMSIV
CIVAAVIIMAINVFTNSQIFNIISYIILFILFFAYVMNIERQDYRRSINVTIPEQYTCNK
PYTAGNKVDVDIPTFNSLNTDDY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative phosphorylated IMV membrane protein (Essential immature viral membrane protein p21) contains a PF05313 domain.

Putative phosphorylated IMV membrane protein (Essential immature viral membrane protein p21) is proteolytically cut by vaccinia virus I7L processing peptidase (C57.001) cleavage. YTAG-NKVD.