Syntaxin 12 (Syntaxin 12, isoform CRA_a) (cDNA FLJ50021, highly similar to Syntaxin-12)

UniProt : B1AJQ7, Q86Y82, UniProt ID: B1AJQ7_HUMAN, STX12_HUMAN,

Syntaxin 12 (Syntaxin 12, isoform CRA_a) (cDNA FLJ50021, highly similar to Syntaxin-12)

Homo sapiens

MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQ
ENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAV
QRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLEL
IKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRA
AYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syntaxin 12 (Syntaxin 12, isoform CRA_a) (cDNA FLJ50021, highly similar to Syntaxin-12) contains a PF00804 domain.

Syntaxin 12 (Syntaxin 12, isoform CRA_a) (cDNA FLJ50021, highly similar to Syntaxin-12) contains a PF05739 domain.

Syntaxin 12 (Syntaxin 12, isoform CRA_a) (cDNA FLJ50021, highly similar to Syntaxin-12) is proteolytically cut by caspase () cleavage. DLID-SIEA.