cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l)

UniProt : A8K057, P02679, UniProt ID: A8K057_HUMAN, FIBG_HUMAN,

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l)

Homo sapiens

MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM
KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) contains a PF00147 domain.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TCVA-YVAT.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. TCVA-YVAT.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NMID-AATL.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. KAIQ-LTYN.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TCVA-YVAT.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. TCVA-YVAT.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NMID-AATL.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. KAIQ-LTYN.

cDNA FLJ75296, highly similar to Homo sapiens fibrinogen, gamma polypeptide (FGG), transcriptvariant gamma-B, mRNA (Fibrinogen gamma chain, isoform CRA_l) is proteolytically cut by inhA g.p. (M06.001) cleavage..