Isoform Gamma-A of Fibrinogen gamma chain

UniProt : P02679, Q53Y18, UniProt ID: P02679-2, Q53Y18_HUMAN,

Isoform Gamma-A of Fibrinogen gamma chain

Homo sapiens

MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM
KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQAGDV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Gamma-A of Fibrinogen gamma chain contains a PF00147 domain.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by streptopain (C10.001) cleavage..

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by streptopain (C10.001) cleavage..

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by fibrinolytic peptidase (M23.003) cleavage. HLGG-AKQV.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by staphylolysin (M23.002) cleavage. HLGG-AKQV.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SKPN-MIDA.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HLGG-AKQV.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TCVA-YVAT.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. TCVA-YVAT.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NMID-AATL.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. KAIQ-LTYN.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by streptopain (C10.001) cleavage..

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by fibrinolytic peptidase (M23.003) cleavage. HLGG-AKQV.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by staphylolysin (M23.002) cleavage. HLGG-AKQV.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. SKPN-MIDA.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HLGG-AKQV.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TCVA-YVAT.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. TCVA-YVAT.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NMID-AATL.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. KAIQ-LTYN.

Isoform Gamma-A of Fibrinogen gamma chain is proteolytically cut by inhA g.p. (M06.001) cleavage..