Cuticle collagen sqt-1

UniProt : P12114, UniProt ID: SQT1_CAEEL,

Cuticle collagen sqt-1

Caenorhabditis elegans

MSVKLACYVTASVTVATLMVCFMTMSTIYSEVDGFREKLDTEMNVFRQSTNGLWKDIVVI
GRSSKRVRRQYEETNATPTPHADGSPSAPPGQPPAVPPVFNQPKTPNGANGNGPTCNCNA
DNKCPAGPSGPKGVPGVPGLDGVPGLDGVPGVGADDIAPQRESVGCFTCPQGPVGPPGAL
GRPGPRGLPGPRGQNGNPGRDGQPGHPGEQGSSGQIGKIGEPGPPGEKGRDAEHPIGRPG
PKGPRGDQGPTGPAGQNGLHGPPGEPGTVGPEGPSGKQGRQGPDGTQGETGPDGRPGKDA
EYCQCPDKSPPSEAVNANRGYRNI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cuticle collagen sqt-1 contains a PF01391 domain.

Cuticle collagen sqt-1 contains a PF01391 domain.

Cuticle collagen sqt-1 contains a PF01484 domain.

Cuticle collagen sqt-1 is proteolytically cut by furin (S08.071) cleavage. RVRR-QYEE.