C-X-C motif chemokine 11

UniProt : O14625, UniProt ID: CXL11_HUMAN,

C-X-C motif chemokine 11

Homo sapiens

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKI
EVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-X-C motif chemokine 11 contains a PF00048 domain.

C-X-C motif chemokine 11 is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. QGFP-MFKR.