cDNA FLJ38671 fis, clone HSYRA2000332, highly similar to Elastin (Elastin (Supravalvular aortic stenosis, Williams-Beuren syndrome), isoform CRA_d)

UniProt : B3KTS6, UniProt ID: B3KTS6_HUMAN,

cDNA FLJ38671 fis, clone HSYRA2000332, highly similar to Elastin (Elastin (Supravalvular aortic stenosis, Williams-Beuren syndrome), isoform CRA_d)

Homo sapiens

MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGG
KPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGG
LGVSAAPSVPGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGV
KPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGV
AGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGI
AGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVP
GAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIP
GVAGVPGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPG
VGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLG
VGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGI
PGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKA
AKYGVAARPGFGLSPIFPGGACLGKACGRKRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ38671 fis, clone HSYRA2000332, highly similar to Elastin (Elastin (Supravalvular aortic stenosis, Williams-Beuren syndrome), isoform CRA_d) is proteolytically cut by gingipain R (C25.001) cleavage..

cDNA FLJ38671 fis, clone HSYRA2000332, highly similar to Elastin (Elastin (Supravalvular aortic stenosis, Williams-Beuren syndrome), isoform CRA_d) is proteolytically cut by gingipain K (C25.002) cleavage..