Proproteinase E
|
UniProt : P05805, UniProt ID: CAC3_BOVIN, Proproteinase E Bos taurus FSQPFSRPSSRVVNGEDAVPYSWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCIST SRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGD KVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPVVDYEHCSQWDWWGIT VKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVS AFIDWIDETIASN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Proproteinase E contains a PF00089 domain.
Proproteinase E is proteolytically cut by pancreatic endopeptidase E (S01.154) cleavage. SRVV-NGED.