Proproteinase E

UniProt : P05805, UniProt ID: CAC3_BOVIN,

Proproteinase E

Bos taurus

FSQPFSRPSSRVVNGEDAVPYSWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCIST
SRTYQVVLGEYDRSVLEGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGD
KVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQQALLPVVDYEHCSQWDWWGIT
VKKTMVCAGGDTRSGCNGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVS
AFIDWIDETIASN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proproteinase E contains a PF00089 domain.

Proproteinase E is proteolytically cut by pancreatic endopeptidase E (S01.154) cleavage. SRVV-NGED.