Leishmanolysin

UniProt : P08148, UniProt ID: GP63_LEIMA,

Leishmanolysin

Leishmania major

MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAGALQHRCVHDAMQARVRQS
VADHHKAPGAVSAVGLPYVTLDAAHTAAAADPRPGSARSVVRDVNWGALRIAVSTEDLTD
PAYHCARVGQHVKDHAGAIVTCTAEDILTNEKRDILVKHLIPQAVQLHTERLKVQQVQGK
WKVTDMVGDICGDFKVPQAHITEGFSNTDFVMYVASVPSEEGVLAWATTCQTFSDGHPAV
GVINIPAANIASRYDQLVTRVVTHEMAHALGFSGPFFEDARIVANVPNVRGKNFDVPVIN
SSTAVAKAREQYGCDTLEYLEVEDQGGAGSAGSHIKMRNAQDELMAPAAAAGYYTALTMA
IFQDLGFYQADFSKAEVMPWGQNAGCAFLTNKCMEQSVTQWPAMFCNESEDAIRCPTSRL
SLGACGVTRHPGLPPYWQYFTDPSLAGVSAFMDYCPVVVPYSDGSCTQRASEAHASLLPF
NVFSDAARCIDGAFRPKATDGIVKSYAGLCANVQCDTATRTYSVQVHGSNDYTNCTPGLR
VELSTVSNAFEGGGYITCPPYVEVCQGNVQAAKDGGNTAAGRRGPRAAATALLVAALLAV
AL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Leishmanolysin contains a PF01457 domain.

Leishmanolysin is proteolytically cut by leishmanolysin (M08.001) cleavage. ARSV-VRDV.