RING finger protein 4

UniProt : Q9QZS2, UniProt ID: RNF4_MOUSE,

RING finger protein 4

Mus musculus

MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEP
VVVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSRDKDVYVTTHTPRST
KDDGATGPRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTC
RKKINHKRYHPIYI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RING finger protein 4 contains a PF00097 domain.

RING finger protein 4 is proteolytically cut by caspase-1 (C14.001) cleavage. ADSC-VVSS.