PMAP: SubstrateDB : Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment)

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment)

UniProt : P01375, Q5STB3, UniProt ID: Q5STB3_HUMAN, TNFA_HUMAN,

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment)

Homo sapiens

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) contains a PF00229 domain.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R1 (C25.001) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. VLFK-GQGC.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. YQTK-VNLL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. SAIK-SPCQ.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R1 (C25.001) cleavage. SSSR-TPSD.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. SSSR-TPSD.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. LNRR-ANAL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. AVRS-SSRT.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R1 (C25.001) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. VLFK-GQGC.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. YQTK-VNLL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. SAIK-SPCQ.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R1 (C25.001) cleavage. SSSR-TPSD.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. SSSR-TPSD.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. LNRR-ANAL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. AVRS-SSRT.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by trepolisin (S08.024) cleavage..

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R1 (C25.001) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. VLFK-GQGC.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. YQTK-VNLL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain K (C25.002) cleavage. SAIK-SPCQ.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R1 (C25.001) cleavage. SSSR-TPSD.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. SSSR-TPSD.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by gingipain R2 (C25.003) cleavage. LNRR-ANAL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. AVRS-SSRT.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. QAVR-SSSR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by trepolisin (S08.024) cleavage..

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. LAQA-VRSS.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. SPLA-QAVR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. AVRS-SSRT.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by membrane-type matrix metallopeptidase-4 (M10.017) cleavage. LAQA-VRSS.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DLSL-ISPL.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. LISP-LAQA.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. SPLA-QAVR.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. LAQA-VRSS.

Tumor necrosis factor (TNF superfamily, member 2) (cDNA, FLJ95875, Homo sapiens tumor necrosis factor (TNF superfamily, member 2)(TNF), mRNA) (TNFA protein) (Fragment) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. LAQA-VRSS.