Glutamyl aminopeptidase

UniProt : Q95334, UniProt ID: AMPE_PIG,

Glutamyl aminopeptidase

Sus scrofa

MSTDSKRYCIKTKHVAIICAAVVAVGLIVGLSVGLTRSCDSKDGGQGTTQSPSHLPPTSS
PPQDQGVCPASEDESGNWRDFRLPDFINPVHYDLQVKPLLEQDTYTGTVNISINVTSPTQ
HLWLHLRETRITQLPVLWRPSGEQVQVRRCFEYKKQEYVVVEAEEELAPNSGEGLYHLTM
EFAGWLNGSLVGFYRTTYVEKGQIKSIAATDHEPTDARKSFPCFDEPNKKATYTISIIHP
KEYKALSNMPVEKEESVDDIWTQTTFQKSVPMSTYLVCFAVHQFDSVTRTSRSGKPLTIY
VQPEQKHTAEYAANITKSVFDYFEDYFAMEYSLPKLDKIAIPDFGTGAMENWGLITYRET
NLLYDPNESASSNQQRVAAVVAHELVHQWFGNIVTMEWWEDLWLNEGFASFFEFLGVDHA
EKEWQMRDQILLEDVLPVQEDDSLISSHPIVVTVSTPAEITSVFDGISYSKGASILRMLE
DWITPEKFQKGCQEYLKKFEFKNAKTSDFWEALEEASNLPVKEVMDTWTNQMGYPVLNVE
DMRIISQKRFLLDPNANSSEPHSVFGYTWNIPVRWTNDNESTITIYNRSETGGITLNSSN
PNGNAFLKINPDHIGFYRVNYEVSTWEWIATNLSLNHKDFSTADRASLIDDAFALARAQL
LNYKEALNLTKYLKMEDEYLPWQRVISAVTYIISMFEDDKELYPMIEKYFRDQVKPIADS
LGWNDNGDHLTKLLRASVLGFACKMGDSNALNNASHLFEQWLTGTVSLPVNLRLLVYRYG
MQNSGNETSWNYTLKQYQETSLAQEKEKLLYGLASVKNVALLSRYLDLLKDPNVIKSQDV
FTVIRYISYNSYGKTMAWNWIQLNWEYLVNRYTLNDRNLGRIVTIAEPFNTELQLWQMES
FFKRYPEAGAGEKPREQVLETVKNNIEWLKQNRDTIRDWFFN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Glutamyl aminopeptidase contains a PF01433 domain.

Glutamyl aminopeptidase is proteolytically cut by () cleavage. SNPN-GNAF.

Glutamyl aminopeptidase is proteolytically cut by () cleavage. SNPN-GNAF.

Glutamyl aminopeptidase is proteolytically cut by trypsin 1 (S01.151) cleavage. CDSK-DGGQ.