Occludin

UniProt : B5BU70, Q16625, UniProt ID: B5BU70_HUMAN, OCLN_HUMAN,

Occludin

Homo sapiens

MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Occludin contains a PF01284 domain.

Occludin contains a PF07303 domain.

Occludin is proteolytically cut by peptidase 1 (C01.073) cleavage. DRGY-GTSL.

Occludin is proteolytically cut by peptidase 1 (C01.073) cleavage. GTSL-LGGS.

Occludin is proteolytically cut by peptidase 1 (C01.073) cleavage. RGYG-TSLL.

Occludin is proteolytically cut by caspase-3 (C14.003) cleavage. ERVD-SPMA.

Occludin is proteolytically cut by peptidase 1 (mite) (C01.073) cleavage..