C-C motif chemokine 24

UniProt : O00175, UniProt ID: CCL24_HUMAN,

C-C motif chemokine 24

Homo sapiens

MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-C motif chemokine 24 contains a PF00048 domain.

C-C motif chemokine 24 is proteolytically cut by tryptase beta (S01.015) cleavage..