Natriuretic peptide A (Natriuretic peptide A variant 2)

UniProt : Q5JZE1, UniProt ID: Q5JZE1_HUMAN,

Natriuretic peptide A (Natriuretic peptide A variant 2)

Homo sapiens

MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Natriuretic peptide A (Natriuretic peptide A variant 2) contains a PF00212 domain.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by oligopeptidase B (S09.010) cleavage..

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by oligopeptidase B (S09.010) cleavage..

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by corin (S01.019) cleavage. TAPR-SLRR.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by corin (S01.019) cleavage. TAPR-SLRR.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. RMDR-IGAQ.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. DRIG-AQSG.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. AQSG-LGCN.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. GCNS-FRY.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. FGGR-MDRI.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. SLRR-SSCF.

Natriuretic peptide A (Natriuretic peptide A variant 2) is proteolytically cut by neprilysin (M13.001) cleavage. RSSC-FGGR.