Nuclease-sensitive element-binding protein 1

UniProt : P67809, UniProt ID: YBOX1_HUMAN,

Nuclease-sensitive element-binding protein 1

Homo sapiens

MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Nuclease-sensitive element-binding protein 1 contains a PF00313 domain.

Nuclease-sensitive element-binding protein 1 is proteolytically cut by caspase () cleavage. VEFD-VVEG.

Nuclease-sensitive element-binding protein 1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VQGE-VMEG.

Nuclease-sensitive element-binding protein 1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. PRED-GNEE.