Adducin 3 (Gamma) (Adducin 3 (Gamma), isoform CRA_a) (cDNA FLJ77558, highly similar to Homo sapiens adducin 3 (gamma) (ADD3), transcript variant 1, mRNA)

UniProt : Q5VU08, Q9UEY8, UniProt ID: ADDG_HUMAN, Q5VU08_HUMAN,

Adducin 3 (Gamma) (Adducin 3 (Gamma), isoform CRA_a) (cDNA FLJ77558, highly similar to Homo sapiens adducin 3 (gamma) (ADD3), transcript variant 1, mRNA)

Homo sapiens

MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQ
ILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPIN
DLPGADTSSYVKGEKLTRCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLS
FSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAV
SSMKCGILPISQESLLLGDVAYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALG
ETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGS
HQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSGG
TPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQF
EDDDHGPPAPPNPFSHLTEGELEEYKRTIERKQQGLEDAEQELLSDDASSVSQIQSQTQS
PQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEI
TIKSPEKIEEVLSPEGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Adducin 3 (Gamma) (Adducin 3 (Gamma), isoform CRA_a) (cDNA FLJ77558, highly similar to Homo sapiens adducin 3 (gamma) (ADD3), transcript variant 1, mRNA) contains a PF00596 domain.

Adducin 3 (Gamma) (Adducin 3 (Gamma), isoform CRA_a) (cDNA FLJ77558, highly similar to Homo sapiens adducin 3 (gamma) (ADD3), transcript variant 1, mRNA) is proteolytically cut by calpain-1 (C02.001) cleavage..