Platelet factor 4

UniProt : P02776, UniProt ID: PLF4_HUMAN,

Platelet factor 4

Homo sapiens

MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Platelet factor 4 contains a PF00048 domain.

Platelet factor 4 is proteolytically cut by () cleavage. VKTT-SQVR.

Platelet factor 4 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..