Coagulation factor X

UniProt : P00743, UniProt ID: FA10_BOVIN,

Coagulation factor X

Bos taurus

MAGLLHLVLLSTALGGLLRPAGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEE
ACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKN
CEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSKSCVSTERFPCGKFTQGRS
RRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDC
AEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEM
AHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIV
SGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPNMFCAGYDTQPEDACQGDSGG
PHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAAGSRGHSEA
PATWTVPPPLPL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coagulation factor X contains a PF00008 domain.

Coagulation factor X contains a PF00594 domain.

Coagulation factor X contains a PF00089 domain.

Coagulation factor X contains a PF00008 domain.

Coagulation factor X is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. QVVR-IVGG.

Coagulation factor X is proteolytically cut by coagulation factor IXa (S01.214) cleavage. QVVR-IVGG.