Tyrosine-protein phosphatase non-receptor type 18

UniProt : Q61152, UniProt ID: PTN18_MOUSE,

Tyrosine-protein phosphatase non-receptor type 18

Mus musculus

MSRHTDLVRSFLEQLEARDYREGAILAREFSDIKARSVAWKSEGVCSTKAGSRLGNTNKN
RYKDVVAYDETRVILSLLQEEGHGDYINANFIRGIDGSQAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACQETENGRRKCERYWAREQEPLKAGPFCITLTKETTLNADITLRTLQVTF
QKEFRSVHQLQYMSWPDHGVPSSSDHILTMVEEARCLQGLGPGPLCVHCSAGCGRTGVLC
AVDYVRQLLLTQTIPPNFSLFQVVLEMRKQRPAAVQTEEQYRFLYHTVAQLFSRTLQDTS
PHYQNLKENCAPICKEAFSLRTSSALPATSRPPGGVLRSISVPAPPTLPMADTYAVVQKR
GASAGTGPGPRAPTSTDTPIYSQVAPRAQRPVAHTEDAQGTTALRRVPADQNSSGPDAYE
EVTDGAQTGGLGFNLRIGRPKGPRDPPAEWTRV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tyrosine-protein phosphatase non-receptor type 18 contains a PF00102 domain.

Tyrosine-protein phosphatase non-receptor type 18 is proteolytically cut by caspase-1 (C14.001) cleavage. EVTD-GAQT.