cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a)

UniProt : B2RCA0, P42224, UniProt ID: B2RCA0_HUMAN, STAT1_HUMAN,

cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a)

Homo sapiens

MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a) contains a PF02864 domain.

cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a) contains a PF02865 domain.

cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a) contains a PF01017 domain.

cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a) contains a PF00017 domain.

cDNA, FLJ95929, Homo sapiens signal transducer and activator of transcription 1,91kDa (STAT1), transcript variant alpha, mRNA (Signal transducer and activator of transcription 1, 91kDa, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. MELD-GPKG.