A disintegrin and metalloproteinase with thrombospondin motifs 4

UniProt : O75173, UniProt ID: ATS4_HUMAN,

A disintegrin and metalloproteinase with thrombospondin motifs 4

Homo sapiens

MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQARALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

A disintegrin and metalloproteinase with thrombospondin motifs 4 contains a PF05986 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 4 contains a PF01562 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 4 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 4 contains a PF01421 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 4 is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. SALT-FREE.

A disintegrin and metalloproteinase with thrombospondin motifs 4 is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. SFRK-FRYG.

A disintegrin and metalloproteinase with thrombospondin motifs 4 is proteolytically cut by furin (S08.071) cleavage. SPSP-RPRR.

A disintegrin and metalloproteinase with thrombospondin motifs 4 is proteolytically cut by furin (S08.071) cleavage. PRPR- RAKR.

A disintegrin and metalloproteinase with thrombospondin motifs 4 is proteolytically cut by furin (S08.071) cleavage. PRRA- KRFA.