Apoptosis regulator Bcl-X

UniProt : Q07817, UniProt ID: BCLX_HUMAN,

Apoptosis regulator Bcl-X

Homo sapiens

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Apoptosis regulator Bcl-X contains a PF02180 domain.

Apoptosis regulator Bcl-X contains a PF00452 domain.

Apoptosis regulator Bcl-X is proteolytically cut by caspase-1 (C14.001) cleavage. HLAD-SPAV.

Apoptosis regulator Bcl-X is proteolytically cut by calpain-1 (C02.001) cleavage. EGTE-SEME.

Apoptosis regulator Bcl-X is proteolytically cut by caspase-1 (C14.001) cleavage. HLAD-SPAV.

Apoptosis regulator Bcl-X is proteolytically cut by calpain-1 (C02.001) cleavage. EGTE-SEME.

Apoptosis regulator Bcl-X is proteolytically cut by caspase-1 (C14.001) cleavage. HLAD-SPAV.