Apoptosis regulator Bcl-X
|
UniProt : Q07817, UniProt ID: BCLX_HUMAN, Apoptosis regulator Bcl-X Homo sapiens MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Apoptosis regulator Bcl-X contains a PF02180 domain.
Apoptosis regulator Bcl-X contains a PF00452 domain.
Apoptosis regulator Bcl-X is proteolytically cut by caspase-1 (C14.001) cleavage. HLAD-SPAV.
Apoptosis regulator Bcl-X is proteolytically cut by calpain-1 (C02.001) cleavage. EGTE-SEME.
Apoptosis regulator Bcl-X is proteolytically cut by caspase-1 (C14.001) cleavage. HLAD-SPAV.
Apoptosis regulator Bcl-X is proteolytically cut by calpain-1 (C02.001) cleavage. EGTE-SEME.
Apoptosis regulator Bcl-X is proteolytically cut by caspase-1 (C14.001) cleavage. HLAD-SPAV.