BCL2-like 1

UniProt : Q5HZH3, Q64373, UniProt ID: BCLX_MOUSE, Q5HZH3_MOUSE,

BCL2-like 1

Mus musculus

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

BCL2-like 1 contains a PF00452 domain.

BCL2-like 1 contains a PF02180 domain.

BCL2-like 1 is proteolytically cut by calpain-2 (C02.002) cleavage. WHLA-DSPA.