CG4385-PB, isoform B

UniProt : A4UZY2, P42519, UniProt ID: A4UZY2_DROME, STAR_DROME,

CG4385-PB, isoform B

Drosophila melanogaster

MSQQVFSAHPALAVDQLQQAEQEEHNTSSNHHQQRSATQSRRHTKAAPKKFTLSRSCAGG
GSGTLSGVHQQVKPSPSNPAISPECRKTLPVRTNYAAVDDDDDIECEDVDEVNFGQQEKE
RERETRQPTKDCGTDETDHVQQRHKNTMTTSATAASRHHHQDGGGGDQSDLSSVISSPSV
STVSSPLSTPTRLPQALQQQLHCCQKSTGMESRARTSPQQIQHPHRQHHQQQHHHHHHHH
HLTAAGCTGGGGGGGGSGGSGSCKAKKLDPRLNPSPYRQLLPIALCLLSFAAVFATLIVY
MDTTEIRHQQFRLNMSRDYELNGVAQDDPALIDFLRQIHMGKYLGKASPKVAAAASVGVG
PPPNSPRLAAAGSTFGSGNSSGSGADQLAHYVADLVGGKMNGAVIQSLSGPLAHLITAPW
LSEQLNWMGVLVEPEPRWYFTLRKQNAQRARMQVVHACVSPNTYPKEITIHNEDVRINSL
HDEETSWFNSRVKCFPLYTIMLACERTEYDLLSLGVQGHELEILQTLPFDKVKIDVISIH
LLEDHEDVADYVLDITRFLAGKSYKLQRKIGRNYFYQRLNASASRTRKKDILLLKTP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CG4385-PB, isoform B is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

CG4385-PB, isoform B is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

CG4385-PB, isoform B is proteolytically cut by Rhomboid-1 (S54.001) cleavage..