Beta-crystallin B1

UniProt : P07318, UniProt ID: CRBB1_BOVIN,

Beta-crystallin B1

Bos taurus

MSQPAAKASATAAVNPGPDGKGKAGPPPGPAPGSGPAPAPAPAPAQPAPAAKAELPPGSY
KLVVFEQENFQGRRVEFSGECLNLGDRGFERVRSIIVTSGPWVAFEQSNFRGEMFVLEKG
EYPRWDTWSSSYRSDRLMSFRPIKMDAQEHKLCLFEGANFKGNTMEIQEDDVPSLWVYGF
CDRVGSVRVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQAVRRLRDRQWHR
EGCFPVLAAEPPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-crystallin B1 contains a PF00030 domain.

Beta-crystallin B1 contains a PF00030 domain.

Beta-crystallin B1 is proteolytically cut by () cleavage. SATA-AVNP.