Lantibiotic mersacidin

UniProt : P43683, UniProt ID: MRSA_BACSY,

Lantibiotic mersacidin

Bacillus sp. (strain HIL-Y85/54728)

MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVC
TLTSECIC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lantibiotic mersacidin is proteolytically cut by mersacidin lantibiotic processing peptidase (C39.004) cleavage. MEAA-CTFT.