Putative uncharacterized protein

UniProt : P31001, Q3V1K9, UniProt ID: DESM_MOUSE, Q3V1K9_MOUSE,

Putative uncharacterized protein

Mus musculus

MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSMTSRVYQVSRTS
GGAGGLGSLRSSRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFAN
YIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERD
NLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKK
VHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVS
DLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEAN
GYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQ
TFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF04732 domain.

Putative uncharacterized protein contains a PF00038 domain.

Putative uncharacterized protein is proteolytically cut by calpain-1 (C02.001) cleavage..

Putative uncharacterized protein is proteolytically cut by calpain-1 (C02.001) cleavage..

Putative uncharacterized protein is proteolytically cut by caspase-6 (C14.005) cleavage. VEMD-MSKP.