Beta-crystallin B1

UniProt : Q9WVJ5, UniProt ID: CRBB1_MOUSE,

Beta-crystallin B1

Mus musculus

MSQAAKASATTAVNPGPDGKGKGAPSTGPAPAPGPTPVPASVPRPAAKVGDLPPGSYRLI
VFEQENFQGRRVEFSGECLNLGDRGFDRVRSLIVVSGPWVAFEQSAFRGEMFVLEKGEYP
RWDTWTSSYRSDRLMSFRPIRMDSQEHKICLFEGANFKGNTMEIQEDDVPSLWVYGFCDR
VGSITVSGGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQAVRRLRDRQWHQEGC
FPVLTAEPPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-crystallin B1 contains a PF00030 domain.

Beta-crystallin B1 contains a PF00030 domain.

Beta-crystallin B1 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RPAA-KVGD.