cDNA, FLJ96463, Homo sapiens H2A histone family, member Z (H2AFZ), mRNA (H2A histone family, member Z)
UniProt : B2RD56, P0C0S5, UniProt ID: B2RD56_HUMAN, H2AZ_HUMAN, cDNA, FLJ96463, Homo sapiens H2A histone family, member Z (H2AFZ), mRNA (H2A histone family, member Z) Homo sapiens MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA, FLJ96463, Homo sapiens H2A histone family, member Z (H2AFZ), mRNA (H2A histone family, member Z) contains a PF00125 domain.
cDNA, FLJ96463, Homo sapiens H2A histone family, member Z (H2AFZ), mRNA (H2A histone family, member Z) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AGKD-SGKA.