Putative uncharacterized protein

UniProt : Q3URU4, Q61216, UniProt ID: MRE11_MOUSE, Q3URU4_MOUSE,

Putative uncharacterized protein

Mus musculus

MSPTDPLDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGD
LFHENKPSRKTLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSKFPWVNYQDGNLNISI
PVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYG
LGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGNTNFIPEQFLDDFIDL
VIWGHEHECKIGPIKNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMQKLP
LRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPGK
PLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGKTGEEINFGMLITK
PASEGATLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLE
KTQRFLKERHIDALEDKIDEEVRRFRESRQRNTNEEDDEVREAMSRARALRSQSETSTSA
FSAEDLSFDTSEQTANDSDDSLSAVPSRGRGRGRGRRGARGQSSAPRGGSQRGRDTGLEI
TTRGRSSKATSSTSRNMSIIDAFRSTRQQPSRNVAPKNYSETIEVDDSDEDDIFPTNSRA
DQRWSGTTSSKRMSQSQTAKGVDFESDEDDDDDPFMSSSCPRRNRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00149 domain.

Putative uncharacterized protein contains a PF04152 domain.

Putative uncharacterized protein is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IEVD-DSDE.