Matrix metalloproteinase-9

UniProt : Q71U09, UniProt ID: Q71U09_CANFA,

Matrix metalloproteinase-9

Canis familiaris

MSPRQPLVLVFLVLGCCSAAPRPHKPTVVVFPGDLRTNLTDKQLAEEYLFRYGYTQVAEL
SDDKQSLSRGLRLLQRRLALPETGELDKTTLEAMRAPRCGVPDLGKFQTFEGDLKWHHND
ITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGPEADIIIQFGVREHGDGYP
FDGKNGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTHFGNADGAPCHFPFTFEGRS
YSACTTDGRSDDTPWCSTTADYDTDRRFGFCPSEKLYTQDGNGDGKPCVFPFTFEGRSYS
TCTTDGRSDGYRWCSTTGDYDQDKLYGFCPTRVDSAVTGGNSAGEPCVFPFIFLGKQYST
CTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSFTEGPPLHEDDVRGIQHLYGPRPEPEPQPPTAPPTAPPTVCATGPPTTRPSERPTA
GPTGPPAAGPTGPPTAGPSEAPTVPVDPAEDICKVNIFDAIAEIRNYLHFFKEGKYWRFS
KGKGRRVQGPFLITDTWPALPRKLDSAFEDGLTKKTFFFSGRQVWVYTGTSVVGPRRLDK
LGLGPEVTQVTGALPQGGGKVLLFSRQRFWSFDVKTQTVDPRSAGSVEQMYPGVPLNTHD
IFQYQEKAYFCQDRFYWRVNSRNEVNQVDEVGYVTFDILQCPED

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Matrix metalloproteinase-9 contains a PF00040 domain.

Matrix metalloproteinase-9 contains a PF00040 domain.

Matrix metalloproteinase-9 contains a PF00040 domain.

Matrix metalloproteinase-9 contains a PF00045 domain.

Matrix metalloproteinase-9 contains a PF00045 domain.

Matrix metalloproteinase-9 contains a PF00045 domain.

Matrix metalloproteinase-9 contains a PF00045 domain.

Matrix metalloproteinase-9 contains a PF00413 domain.

Matrix metalloproteinase-9 contains a PF01471 domain.

Matrix metalloproteinase-9 contains a PF04886 domain.

Matrix metalloproteinase-9 is proteolytically cut by chymase (human-type) (S01.140) cleavage. FQTF-EGDL.

Matrix metalloproteinase-9 is proteolytically cut by chymase (human-type) (S01.140) cleavage. LGKF-QTFE.