Colony stimulating factor 3 (Granulocyte) (Colony stimulating factor 3 (Granulocyte), isoform CRA_a) (cDNA FLJ76606, highly similar to Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, mRNA)
|
UniProt : Q8N4W3, UniProt ID: Q8N4W3_HUMAN, Colony stimulating factor 3 (Granulocyte) (Colony stimulating factor 3 (Granulocyte), isoform CRA_a) (cDNA FLJ76606, highly similar to Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, mRNA) Homo sapiens MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEK LCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEG ISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVA SHLQSFLEVSYRVLRHLAQP The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Colony stimulating factor 3 (Granulocyte) (Colony stimulating factor 3 (Granulocyte), isoform CRA_a) (cDNA FLJ76606, highly similar to Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, mRNA) contains a PF00489 domain.
Colony stimulating factor 3 (Granulocyte) (Colony stimulating factor 3 (Granulocyte), isoform CRA_a) (cDNA FLJ76606, highly similar to Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, mRNA) is proteolytically cut by neutrophil elastase (S01.131) cleavage..