Homo sapiens

MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. PPGD-LRTH.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. SPQS-LSAA.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. PPGD-LRTH.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. SPQS-LSAA.

is proteolytically cut by furin (S08.071) cleavage. RRKR-YAIQ.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. QLYG-GESG.

is proteolytically cut by plasmin (S01.233) cleavage. ANVR-RKRY.

is proteolytically cut by plasmin (S01.233) cleavage. RRKR-YAIQ.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DPSA-IMAP.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. RRKR-YAIQ.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. QGLK-WQHN.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. FCIQ-NYTP.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. AEPW-TVRN.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. QQLY-GGES.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. PQPR-TTSR.