CDKN1B protein (Cyclin-dependent kinase inhibitor 1B (P27, Kip1), isoform CRA_a) (cDNA, FLJ92816, Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1)(CDKN1B), mRNA) (Cyclin-dependent kinase inhibitor 1B)

UniProt : P46527, Q6I9V6, UniProt ID: CDN1B_HUMAN, Q6I9V6_HUMAN,

CDKN1B protein (Cyclin-dependent kinase inhibitor 1B (P27, Kip1), isoform CRA_a) (cDNA, FLJ92816, Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1)(CDKN1B), mRNA) (Cyclin-dependent kinase inhibitor 1B)

Homo sapiens

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CDKN1B protein (Cyclin-dependent kinase inhibitor 1B (P27, Kip1), isoform CRA_a) (cDNA, FLJ92816, Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1)(CDKN1B), mRNA) (Cyclin-dependent kinase inhibitor 1B) contains a PF02234 domain.

CDKN1B protein (Cyclin-dependent kinase inhibitor 1B (P27, Kip1), isoform CRA_a) (cDNA, FLJ92816, Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1)(CDKN1B), mRNA) (Cyclin-dependent kinase inhibitor 1B) is proteolytically cut by caspase-3 (C14.003) cleavage. DPSD-SQTG.

CDKN1B protein (Cyclin-dependent kinase inhibitor 1B (P27, Kip1), isoform CRA_a) (cDNA, FLJ92816, Homo sapiens cyclin-dependent kinase inhibitor 1B (p27, Kip1)(CDKN1B), mRNA) (Cyclin-dependent kinase inhibitor 1B) is proteolytically cut by caspase-3 (C14.003) cleavage. ESQD-VSGS .