Lantibiotic mutacin-1140

UniProt : O68586, UniProt ID: LANN_STRMU,

Lantibiotic mutacin-1140

Streptococcus mutans

MSNTQLLEVLGTETFDVQEDLFAFDTTDTTIVASNDDPDTRFKSWSLCTPGCARTGSFNS
YCC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lantibiotic mutacin-1140 contains a PF02052 domain.

Lantibiotic mutacin-1140 is proteolytically cut by MutP lantibiotic leader peptidase (S08.065) cleavage. PDTR-FKSW.