Lipase, endothelial (Lipase, endothelial, isoform CRA_a)

UniProt : B0LPG6, Q9Y5X9, UniProt ID: B0LPG6_HUMAN, LIPE_HUMAN,

Lipase, endothelial (Lipase, endothelial, isoform CRA_a)

Homo sapiens

MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Lipase, endothelial (Lipase, endothelial, isoform CRA_a) contains a PF00151 domain.

Lipase, endothelial (Lipase, endothelial, isoform CRA_a) contains a PF01477 domain.

Lipase, endothelial (Lipase, endothelial, isoform CRA_a) is proteolytically cut by convertase subtilisin/kexin type 5 () cleavage. RNKR-NSKM.