Caspase-14 (Caspase 14, apoptosis-related cysteine peptidase) (cDNA, FLJ94644, Homo sapiens caspase 14, apoptosis-related cysteine protease(CASP14), mRNA)
|
UniProt : B2CIS9, P31944, UniProt ID: B2CIS9_HUMAN, CASPE_HUMAN, Caspase-14 (Caspase 14, apoptosis-related cysteine peptidase) (cDNA, FLJ94644, Homo sapiens caspase 14, apoptosis-related cysteine protease(CASP14), mRNA) Homo sapiens MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQ FQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQAL RAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRH DQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY LQ The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Caspase-14 (Caspase 14, apoptosis-related cysteine peptidase) (cDNA, FLJ94644, Homo sapiens caspase 14, apoptosis-related cysteine protease(CASP14), mRNA) contains a PF00656 domain.
Caspase-14 (Caspase 14, apoptosis-related cysteine peptidase) (cDNA, FLJ94644, Homo sapiens caspase 14, apoptosis-related cysteine protease(CASP14), mRNA) is proteolytically cut by calpain-1 (C02.001) cleavage. VMVI-KDSP.