PMAP: SubstrateDB :

Homo sapiens

MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. FPGD-LRTN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAL-LLLQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LSLP-ETGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. TLKA-MRTP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PALL-LLQK.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. FPGD-LRTN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAL-LLLQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LSLP-ETGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. TLKA-MRTP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PALL-LLQK.

is proteolytically cut by streptopain (C10.001) cleavage..

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. FPGD-LRTN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAL-LLLQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LSLP-ETGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. TLKA-MRTP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PALL-LLQK.

is proteolytically cut by streptopain (C10.001) cleavage..

is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. TLKA-MRTP.

is proteolytically cut by trypsin-2 (S01.258) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-10 (M10.006) cleavage. DLGR-FQTF.

is proteolytically cut by thermolysin (M04.001) cleavage. RFQT-FEGD.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TLKA-MRTP.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DLGR-FQTF.

is proteolytically cut by pseudolysin (M04.005) cleavage. RFQT-FEGD.

is proteolytically cut by vibriolysin (M04.003) cleavage. RFQT-FEGD.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. FPGD-LRTN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAL-LLLQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LSLP-ETGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. TLKA-MRTP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PALL-LLQK.

is proteolytically cut by streptopain (C10.001) cleavage..

is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. TLKA-MRTP.

is proteolytically cut by trypsin-2 (S01.258) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-10 (M10.006) cleavage. DLGR-FQTF.

is proteolytically cut by thermolysin (M04.001) cleavage. RFQT-FEGD.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TLKA-MRTP.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DLGR-FQTF.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. RVAE-MRGE.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DLGR-FQTF.

is proteolytically cut by pseudolysin (M04.005) cleavage. RFQT-FEGD.

is proteolytically cut by vibriolysin (M04.003) cleavage. RFQT-FEGD.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QSTL-VLFP.