Signal transducer and transcription activator 6

UniProt : P52633, UniProt ID: STAT6_MOUSE,

Signal transducer and transcription activator 6

Mus musculus

MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSAT
VQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGP
FHRKQEELKFTTPLGRLHHRVRETRLLRESLHLGPKTGQVSLQNLIDPPLNGPGPSEDLP
TILQGTVGDLETTQPLVLLRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLHQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSTKPPMVRADMVTEKQARELSLSQGPGTGVESTGEIMNNTVPLENSIPSNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLSLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVGERVPWEKMCETLNLKFMVEVGTSRGLLPEHFLFLAQK
IFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNM
SQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLWSDVTMVEDSCLTQPVGGFPQGTWVSED
MYPPLLPPTEQDLTKLLLENQGEGGGSLGSQPLLKPSPYGQSGISLSHLDLRTNPSW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Signal transducer and transcription activator 6 contains a PF01017 domain.

Signal transducer and transcription activator 6 contains a PF02865 domain.

Signal transducer and transcription activator 6 contains a PF02864 domain.

Signal transducer and transcription activator 6 contains a PF00017 domain.

Signal transducer and transcription activator 6 is proteolytically cut by calpain-2 (C02.002) cleavage..

Signal transducer and transcription activator 6 is proteolytically cut by serine protease () cleavage..