cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican)

UniProt : B2R6R5, P51884, UniProt ID: B2R6R5_HUMAN, LUM_HUMAN,

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican)

Homo sapiens

MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF00560 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) contains a PF01462 domain.

cDNA, FLJ93075, Homo sapiens lumican (LUM), mRNA (Lumican) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage..