Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a)
|
UniProt : Q1RMZ2, UniProt ID: Q1RMZ2_HUMAN, Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a) Homo sapiens MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER CALPGYPGVYTNLCKYRSWIEETMRDK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a) contains a PF00089 domain.
Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. DENK-IIGG.