Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a)

UniProt : Q1RMZ2, UniProt ID: Q1RMZ2_HUMAN,

Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a)

Homo sapiens

MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLA
GPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYN
SRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQC
VNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMER
CALPGYPGVYTNLCKYRSWIEETMRDK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a) contains a PF00089 domain.

Kallikrein-related peptidase 14 (Kallikrein 14, isoform CRA_a) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. DENK-IIGG.