cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7)

UniProt : B2R5F3, P02775, UniProt ID: B2R5F3_HUMAN, CXCL7_HUMAN,

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7)

Homo sapiens

MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAE
LRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKK
LAGDESAD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) contains a PF00048 domain.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RIKK-IVQK.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LDSD-LYAE.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VIAT-LKDG.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QSLE-VIGK.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. HPKN-IQSL.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LYAE-LRCM.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. ELRC-MCIK.

cDNA, FLJ92452, Homo sapiens pro-platelet basic protein (chemokine (C-X-C motif)ligand 7) (PPBP), mRNA (Pro-platelet basic protein) (Chemokine (C-X-C motif) ligand 7) is proteolytically cut by cathepsin G (S01.133) cleavage..