B-cell receptor-associated protein 31

UniProt : P51572, UniProt ID: BAP31_HUMAN,

B-cell receptor-associated protein 31

Homo sapiens

MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILV
LLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEE
NRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
MDKKEE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

B-cell receptor-associated protein 31 contains a PF05529 domain.

B-cell receptor-associated protein 31 is proteolytically cut by caspase () cleavage. AAVD-GGKL.

B-cell receptor-associated protein 31 is proteolytically cut by caspase () cleavage. AAVD-GGKL.

B-cell receptor-associated protein 31 is proteolytically cut by caspase-8 (C14.009) cleavage. AAVD-GGKL.

B-cell receptor-associated protein 31 is proteolytically cut by caspase-8 (C14.009) cleavage. AAVD-GPMD.