LPS-induced CXC chemokine

UniProt : Q8K3I3, UniProt ID: Q8K3I3_MOUSE,

LPS-induced CXC chemokine

Mus musculus

MSLQLRSSARIPSGSISPFMRMAPLAFLLLFTLPQHLAEAAPSSVIAATELRCVCLTVTP
KINPKLIANLEVIPAGPQCPTVEVIAKLKNQKEVCLDPEAPVIKKIIQKILGSDKKKAKR
NALAVERTASVQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

LPS-induced CXC chemokine contains a PF00048 domain.

LPS-induced CXC chemokine is proteolytically cut by cell envelope proteinase A (S08.027) cleavage..