LIX protein

UniProt : P50228, Q790R4, UniProt ID: CXCL5_MOUSE, Q790R4_MOUSE,

LIX protein

Mus musculus

MSLQLRSSAHIPSGSSSPFMRMAPLAFLLLFTLPQHLAEAAPSSVIAATELRCVCLTVTP
KINPKLIANLEVIPAGPQCPTVEVIAKLKNQKEVCLDPEAPVIKKIIQKILGSDKKKAKR
NALAVERTASVQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

LIX protein contains a PF00048 domain.

LIX protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. KKAK-RNAL.

LIX protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. APSS-VIAA.

LIX protein is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. KKAK-RNAL.

LIX protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. APSS-VIAA.