cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA

UniProt : B2R4X3, P80162, UniProt ID: B2R4X3_HUMAN, CXCL6_HUMAN,

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA

Homo sapiens

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA contains a PF00048 domain.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. PFLK-KVIQ.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by cell envelope proteinase A (S08.027) cleavage. PFLK-KVIQ.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPVS-AVLT.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PVSA-VLTE.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VSAV-LTEL.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. PVSA-VLTE.

cDNA, FLJ92254, Homo sapiens chemokine (C-X-C motif) ligand 6 (granulocytechemotactic protein 2) (CXCL6), mRNA is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. VSAV-LTEL.